| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class pi GST [81358] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries) |
| Domain d5dcgb1: 5dcg B:2-76 [326967] Other proteins in same PDB: d5dcga2, d5dcgb2 automated match to d13gsa2 complexed with ca, mes, po4 |
PDB Entry: 5dcg (more details), 2.01 Å
SCOPe Domain Sequences for d5dcgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dcgb1 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl
Timeline for d5dcgb1: