Lineage for d5gjsb_ (5gjs B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267805Species Influenza a virus [TaxId:1454272] [275804] (3 PDB entries)
  8. 2267809Domain d5gjsb_: 5gjs B: [326958]
    Other proteins in same PDB: d5gjsa1, d5gjsa2, d5gjsl1, d5gjsl2
    automated match to d5bnyf_
    complexed with nag

Details for d5gjsb_

PDB Entry: 5gjs (more details), 2.9 Å

PDB Description: crystal structure of h1 hemagglutinin from a/california/04/2009 in complex with a neutralizing antibody 3e1
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5gjsb_:

Sequence, based on SEQRES records: (download)

>d5gjsb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
gaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmntqf
tavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvr
sqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

Sequence, based on observed residues (ATOM records): (download)

>d5gjsb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
gaiafieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmntqft
avgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrs
qlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

SCOPe Domain Coordinates for d5gjsb_:

Click to download the PDB-style file with coordinates for d5gjsb_.
(The format of our PDB-style files is described here.)

Timeline for d5gjsb_: