SCOPe 2.06: Domain d5ez5b_: 5ez5 B:

Lineage for d5ez5b_ (5ez5 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d5ez5b_: 5ez5 B: [326956]
   automated match to d4uj3d_
   complexed with gtp, mg

Details for d5ez5b_

PDB Entry: 5ez5, 2.4 Å

PDB Description: crystal structure of active rab11a (s20v) in complex with gtp

PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d5ez5b_:

Sequence; same for both SEQRES and ATOM records:

>d5ez5b_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdvgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

Timeline for d5ez5b_:

• d5ez5b_ is new in SCOPe 2.06-stable
  
• d5ez5b_ appears in SCOPe 2.07
  
• d5ez5b_ appears in the current release, SCOPe 2.08