Lineage for d1larb1 (1lar B:1340-1623)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70708Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 70709Protein RPTP Lar [52815] (1 species)
  7. 70710Species Human (Homo sapiens) [TaxId:9606] [52816] (1 PDB entry)
  8. 70713Domain d1larb1: 1lar B:1340-1623 [32695]

Details for d1larb1

PDB Entry: 1lar (more details), 2 Å

PDB Description: crystal structure of the tandem phosphatase domains of rptp lar

SCOP Domain Sequences for d1larb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1larb1 c.45.1.2 (B:1340-1623) RPTP Lar {Human (Homo sapiens)}
twensnlevnkpknryanviaydhsrviltsidgvpgsdyinanyidgyrkqnayiatqg
plpetmgdfwrmvweqrtatvvmmtrleeksrvkcdqywpargtetcgliqvtlldtvel
atytvrtfalhksgssekrelrqfqfmawpdhgvpeyptpilaflrrvkacnpldagpmv
vhcsagvgrtgcfividamlermkhektvdiyghvtcmrsqrnymvqtedqyvfiheall
eaatcghtevparnlyahiqklgqvppgesvtamelefkllass

SCOP Domain Coordinates for d1larb1:

Click to download the PDB-style file with coordinates for d1larb1.
(The format of our PDB-style files is described here.)

Timeline for d1larb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1larb2