![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
![]() | Protein automated matches [190459] (60 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries) |
![]() | Domain d5h7xb_: 5h7x B: [326942] Other proteins in same PDB: d5h7xe2, d5h7xf2 automated match to d3f3ma_ complexed with cit |
PDB Entry: 5h7x (more details), 1.76 Å
SCOPe Domain Sequences for d5h7xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7xb_ c.26.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]} msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw
Timeline for d5h7xb_: