SCOPe 2.07: Domain d5h7xf1: 5h7x F:1-163

Lineage for d5h7xf1 (5h7x F:1-163)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (57 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries)

8. Domain d5h7xf1: 5h7x F:1-163 [326940]
   Other proteins in same PDB: d5h7xe2, d5h7xf2
   automated match to d3f3ma_
   complexed with cit

Details for d5h7xf1

PDB Entry: 5h7x, 1.76 Å

PDB Description: crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with 2-hydroxy-1,2, 3-propane tricarboxylate at 1.76 a resolution

PDB Compounds: (F:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5h7xf1:

Sequence; same for both SEQRES and ATOM records:

>d5h7xf1 c.26.1.0 (F:1-163) automated matches {Acinetobacter baumannii [TaxId: 470]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

Timeline for d5h7xf1:

• d5h7xf1 first appeared in SCOPe 2.06