SCOP 1.59: Domain d1lara2: 1lar A:1628-1876

Lineage for d1lara2 (1lar A:1628-1876)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)

6. Protein RPTP Lar [52815] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52816] (1 PDB entry)

8. Domain d1lara2: 1lar A:1628-1876 [32694]

Details for d1lara2

PDB Entry: 1lar, 2 Å

PDB Description: crystal structure of the tandem phosphatase domains of rptp lar

SCOP Domain Sequences for d1lara2:

Sequence; same for both SEQRES and ATOM records:

>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens)}
srfisanlpcnkfknrlvnimpyeltrvclqpirgvegsdyinasfldgyrqqkayiatq
gplaestedfwrmlwehnstiivmltklremgrekchqywpaersaryqyfvvdpmaeyn
mpqyilrefkvtdardgqsrtirqfqftdwpeqgvpktgegfidfigqvhktkeqfgqdg
pitvhcsagvgrtgvfitlsivlermryegvvdmfqtvktlrtqrpamvqtedqyqlcyr
aaleylgsf

Timeline for d1lara2:

• d1lara2 first appeared (with stable ids) in SCOP 1.55
  
• d1lara2 appears in SCOP 1.57
  
• d1lara2 appears in SCOP 1.61
  
• d1lara2 appears in the current release, SCOPe 2.08