Lineage for d5gjsl2 (5gjs L:107-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363364Domain d5gjsl2: 5gjs L:107-212 [326935]
    Other proteins in same PDB: d5gjsa1, d5gjsa2, d5gjsb_, d5gjsl1
    automated match to d1dn0a2
    complexed with nag

Details for d5gjsl2

PDB Entry: 5gjs (more details), 2.9 Å

PDB Description: crystal structure of h1 hemagglutinin from a/california/04/2009 in complex with a neutralizing antibody 3e1
PDB Compounds: (L:) light chain of human neutralizing antibody 3E1

SCOPe Domain Sequences for d5gjsl2:

Sequence, based on SEQRES records: (download)

>d5gjsl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Sequence, based on observed residues (ATOM records): (download)

>d5gjsl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvnalqsnsqesvteqds
kdstyslsstltldyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5gjsl2:

Click to download the PDB-style file with coordinates for d5gjsl2.
(The format of our PDB-style files is described here.)

Timeline for d5gjsl2: