Lineage for d5f07a2 (5f07 A:82-213)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2323218Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (9 PDB entries)
  8. 2323220Domain d5f07a2: 5f07 A:82-213 [326933]
    Other proteins in same PDB: d5f07a1
    automated match to d4ri6a2
    complexed with gsh

Details for d5f07a2

PDB Entry: 5f07 (more details), 1.5 Å

PDB Description: crystal structure of glutathione transferase f8 from populus trichocarpa
PDB Compounds: (A:) Putative glutathione S-transferase family protein

SCOPe Domain Sequences for d5f07a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f07a2 a.45.1.0 (A:82-213) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gpnllgntleekalvdqwleieahnfndlvfnivfqvvilprigqqgdselvrtyeekle
kvldvyekrlskskylagdsftladlshlpatrylvneaglghlvkdrkklnawwediss
rpawkklmnlag

SCOPe Domain Coordinates for d5f07a2:

Click to download the PDB-style file with coordinates for d5f07a2.
(The format of our PDB-style files is described here.)

Timeline for d5f07a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f07a1