SCOPe 2.08: Domain d5f07a2: 5f07 A:82-213

Lineage for d5f07a2 (5f07 A:82-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries)

8. Domain d5f07a2: 5f07 A:82-213 [326933]
   Other proteins in same PDB: d5f07a1
   automated match to d4ri6a2
   complexed with gsh

Details for d5f07a2

PDB Entry: 5f07, 1.5 Å

PDB Description: crystal structure of glutathione transferase f8 from populus trichocarpa

PDB Compounds: (A:) Putative glutathione S-transferase family protein

SCOPe Domain Sequences for d5f07a2:

Sequence; same for both SEQRES and ATOM records:

>d5f07a2 a.45.1.0 (A:82-213) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gpnllgntleekalvdqwleieahnfndlvfnivfqvvilprigqqgdselvrtyeekle
kvldvyekrlskskylagdsftladlshlpatrylvneaglghlvkdrkklnawwediss
rpawkklmnlag

Timeline for d5f07a2:

• d5f07a2 first appeared in SCOPe 2.06
  
• d5f07a2 appears in SCOPe 2.07