Lineage for d5gp1b_ (5gp1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895162Species Zika virus [TaxId:64320] [326922] (1 PDB entry)
  8. 2895164Domain d5gp1b_: 5gp1 B: [326927]
    automated match to d2oxta_
    complexed with gta, ni, sah, so4

Details for d5gp1b_

PDB Entry: 5gp1 (more details), 2.44 Å

PDB Description: crystal structure of zikv ns5 methyltransferase in complex with gtp and sah
PDB Compounds: (B:) RNA-directed RNA polymerase NS5

SCOPe Domain Sequences for d5gp1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gp1b_ c.66.1.0 (B:) automated matches {Zika virus [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtra

SCOPe Domain Coordinates for d5gp1b_:

Click to download the PDB-style file with coordinates for d5gp1b_.
(The format of our PDB-style files is described here.)

Timeline for d5gp1b_: