| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
| Protein automated matches [190689] (87 species) not a true protein |
| Species Zika virus [TaxId:64320] [326922] (1 PDB entry) |
| Domain d5gp1b_: 5gp1 B: [326927] automated match to d2oxta_ complexed with gta, ni, sah, so4 |
PDB Entry: 5gp1 (more details), 2.44 Å
SCOPe Domain Sequences for d5gp1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gp1b_ c.66.1.0 (B:) automated matches {Zika virus [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtra
Timeline for d5gp1b_: