Lineage for d5gozc_ (5goz C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2147063Species Zika virus (strain mr 766) [TaxId:64320] [326915] (1 PDB entry)
  8. 2147066Domain d5gozc_: 5goz C: [326924]
    automated match to d2oxta_
    complexed with gtp, po4, pop, sah, sin

Details for d5gozc_

PDB Entry: 5goz (more details), 2.05 Å

PDB Description: crystal structure of zikv ns5 methyltransferase in complex with gtp and sah
PDB Compounds: (C:) RNA-directed RNA polymerase NS5

SCOPe Domain Sequences for d5gozc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gozc_ c.66.1.0 (C:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
tgetlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklr
wlvergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwni
vrlksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikv
lcpytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgr
mdgprrpvkyeedvnlgsgtr

SCOPe Domain Coordinates for d5gozc_:

Click to download the PDB-style file with coordinates for d5gozc_.
(The format of our PDB-style files is described here.)

Timeline for d5gozc_: