Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein SptP tyrosine phosphatase, catalytic domain [52813] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [52814] (2 PDB entries) |
Domain d1g4wr2: 1g4w R:297-539 [32692] Other proteins in same PDB: d1g4wr1 |
PDB Entry: 1g4w (more details), 2.2 Å
SCOPe Domain Sequences for d1g4wr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4wr2 c.45.1.2 (R:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknsnqngapgrsssdkhl pmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaq llm
Timeline for d1g4wr2: