SCOP 1.71: Domain d1g4us2: 1g4u S:297-539

Lineage for d1g4us2 (1g4u S:297-539)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein SptP tyrosine phosphatase, catalytic domain [52813] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52814] (2 PDB entries)

8. Domain d1g4us2: 1g4u S:297-539 [32691]
   Other proteins in same PDB: d1g4ur_, d1g4us1
   complexed with af3, gdp, mg; mutant

Details for d1g4us2

PDB Entry: 1g4u, 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

SCOP Domain Sequences for d1g4us2:

Sequence, based on SEQRES records:

>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium}
pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda
leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid
qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknsnqngapgrsssdkhl
pmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaq
llm

Sequence, based on observed residues (ATOM records):

>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium}
pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda
leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid
qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknkhlpmihclggvgrtg
tmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm

Timeline for d1g4us2:

• d1g4us2 first appeared (with stable ids) in SCOP 1.55
  
• d1g4us2 appears in SCOP 1.69
  
• d1g4us2 appears in SCOP 1.73
  
• d1g4us2 appears in the current release, SCOPe 2.08