Lineage for d1g4us2 (1g4u S:297-539)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24024Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 protein domains)
  6. 24031Protein SptP tyrosine phosphatase, catalytic domain [52813] (1 species)
  7. 24032Species Salmonella typhimurium [TaxId:90371] [52814] (2 PDB entries)
  8. 24033Domain d1g4us2: 1g4u S:297-539 [32691]
    Other proteins in same PDB: d1g4ur_, d1g4us1

Details for d1g4us2

PDB Entry: 1g4u (more details), 2.3 Å

PDB Description: crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1

SCOP Domain Sequences for d1g4us2:

Sequence, based on SEQRES records: (download)

>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium}
pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda
leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid
qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknsnqngapgrsssdkhl
pmihclggvgrtgtmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaq
llm

Sequence, based on observed residues (ATOM records): (download)

>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium}
pqtmsgptlglarfavssipinqqtqvklsdgmpvpvntltfdgkpvalagsypkntpda
leahmkmllekecsclvvltsedqmqakqlppyfrgsytfgevhtnsqkvssasqgeaid
qynmqlscgekrytipvlhvknwpdhqplpstdqleyladrvknkhlpmihclggvgrtg
tmaaalvlkdnphsnleqvradfrdsrnnrmledasqfvqlkamqaqllm

SCOP Domain Coordinates for d1g4us2:

Click to download the PDB-style file with coordinates for d1g4us2.
(The format of our PDB-style files is described here.)

Timeline for d1g4us2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4us1
View in 3D
Domains from other chains:
(mouse over for more information)
d1g4ur_