Lineage for d5gjtb_ (5gjt B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646405Species Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId:1454272] [275804] (6 PDB entries)
  8. 2646415Domain d5gjtb_: 5gjt B: [326909]
    Other proteins in same PDB: d5gjta1, d5gjta2, d5gjtl1, d5gjtl2
    automated match to d5bnyf_
    complexed with nag

Details for d5gjtb_

PDB Entry: 5gjt (more details), 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5gjtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjtb_ h.3.1.0 (B:) automated matches {Influenza A virus (a/chicken/guangdong/s1311/2010(h6n6)) [TaxId: 1454272]}
aiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmntqft
avgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrn
qlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln

SCOPe Domain Coordinates for d5gjtb_:

Click to download the PDB-style file with coordinates for d5gjtb_.
(The format of our PDB-style files is described here.)

Timeline for d5gjtb_: