SCOPe 2.06: Domain d5gjtb_: 5gjt B:

Lineage for d5gjtb_ (5gjt B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus [TaxId:1454272] [275804] (3 PDB entries)

8. Domain d5gjtb_: 5gjt B: [326909]
   Other proteins in same PDB: d5gjta1, d5gjta2, d5gjtl1, d5gjtl2
   automated match to d5bnyf_
   complexed with nag

Details for d5gjtb_

PDB Entry: 5gjt, 3.1 Å

PDB Description: crystal structure of h1 hemagglutinin from a/washington/05/2011 in complex with a neutralizing antibody 3e1

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5gjtb_:

Sequence; same for both SEQRES and ATOM records:

>d5gjtb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
aiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidkitnkvnsviekmntqft
avgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyekvrn
qlknnakeigngcfefyhkcdntcmesvkngtydypkyseeakln

Timeline for d5gjtb_:

• d5gjtb_ is new in SCOPe 2.06-stable
  
• d5gjtb_ appears in SCOPe 2.07
  
• d5gjtb_ appears in the current release, SCOPe 2.08