| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
| Protein automated matches [194413] (5 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries) |
| Domain d5g49b_: 5g49 B: [326904] Other proteins in same PDB: d5g49a2 automated match to d4csrb_ complexed with act, ca |
PDB Entry: 5g49 (more details), 2.3 Å
SCOPe Domain Sequences for d5g49b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g49b_ a.22.1.3 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tqfkeiekttdfknhslplarikkimkadedvrmisaeapvvfaracemfileltlrswn
hteenkrrtlqkndiaaavtrtdifdflvdivpr
Timeline for d5g49b_: