SCOPe 2.08: Domain d5g49b_: 5g49 B:

Lineage for d5g49b_ (5g49 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein automated matches [194413] (5 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries)

8. Domain d5g49b_: 5g49 B: [326904]
   Other proteins in same PDB: d5g49a2
   automated match to d4csrb_
   complexed with act, ca

Details for d5g49b_

PDB Entry: 5g49, 2.3 Å

PDB Description: crystal structure of the arabodopsis thaliana histone-fold dimer l1l nf-yc3

PDB Compounds: (B:) nuclear transcription factor y subunit c-3

SCOPe Domain Sequences for d5g49b_:

Sequence; same for both SEQRES and ATOM records:

>d5g49b_ a.22.1.3 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tqfkeiekttdfknhslplarikkimkadedvrmisaeapvvfaracemfileltlrswn
hteenkrrtlqkndiaaavtrtdifdflvdivpr

Timeline for d5g49b_:

• d5g49b_ first appeared in SCOPe 2.06
  
• d5g49b_ appears in SCOPe 2.07