Lineage for d1yts__ (1yts -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584246Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 584247Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 584295Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 584300Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)
  7. 584301Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries)
  8. 584310Domain d1yts__: 1yts - [32690]
    complexed with so4; mutant

Details for d1yts__

PDB Entry: 1yts (more details), 2.5 Å

PDB Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase

SCOP Domain Sequences for d1yts__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yts__ c.45.1.2 (-) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica}
pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOP Domain Coordinates for d1yts__:

Click to download the PDB-style file with coordinates for d1yts__.
(The format of our PDB-style files is described here.)

Timeline for d1yts__: