![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
![]() | Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species) |
![]() | Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries) |
![]() | Domain d1yts__: 1yts - [32690] complexed with so4; mutant |
PDB Entry: 1yts (more details), 2.5 Å
SCOP Domain Sequences for d1yts__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yts__ c.45.1.2 (-) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica} pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d1yts__: