SCOP 1.69: Domain d1yts__: 1yts -

Lineage for d1yts__ (1yts -)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries)

8. Domain d1yts__: 1yts - [32690]

Details for d1yts__

PDB Entry: 1yts, 2.5 Å

PDB Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase

SCOP Domain Sequences for d1yts__:

Sequence; same for both SEQRES and ATOM records:

>d1yts__ c.45.1.2 (-) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica}
pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d1yts__:

• d1yts__ first appeared (with stable ids) in SCOP 1.55
  
• d1yts__ appears in SCOP 1.67
  
• d1yts__ appears in SCOP 1.71
  
• d1yts__ appears in the current release, SCOPe 2.08, called d1ytsa_