Lineage for d1yts__ (1yts -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24024Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 24035Protein Tyrosine phosphatase [52806] (6 species)
  7. 24072Species Yersinia enterocolitica [TaxId:630] [52812] (4 PDB entries)
  8. 24077Domain d1yts__: 1yts - [32690]

Details for d1yts__

PDB Entry: 1yts (more details), 2.5 Å

PDB Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase

SCOP Domain Sequences for d1yts__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yts__ c.45.1.2 (-) Tyrosine phosphatase {Yersinia enterocolitica}
pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOP Domain Coordinates for d1yts__:

Click to download the PDB-style file with coordinates for d1yts__.
(The format of our PDB-style files is described here.)

Timeline for d1yts__: