SCOPe 2.08: Domain d1ytsa_: 1yts A:

Lineage for d1ytsa_ (1yts A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (20 PDB entries)

8. Domain d1ytsa_: 1yts A: [32690]
   complexed with so4

Details for d1ytsa_

PDB Entry: 1yts, 2.5 Å

PDB Description: a ligand-induced conformational change in the yersinia protein tyrosine phosphatase

PDB Compounds: (A:) yersinia protein tyrosine phosphatase

SCOPe Domain Sequences for d1ytsa_:

Sequence; same for both SEQRES and ATOM records:

>d1ytsa_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
pearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnanyiq
vgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgtygs
itveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkalas
lvdqtaetkrnmyeskgssavaddsklrpvihsragvgrtaqligamcmndsrnsqlsve
dmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d1ytsa_:

• d1ytsa_ first appeared (with stable ids) in SCOP 1.55, called d1yts__
  
• d1ytsa_ appears in SCOPe 2.07