![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein automated matches [194413] (5 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [326898] (3 PDB entries) |
![]() | Domain d5g49a1: 5g49 A:55-147 [326899] Other proteins in same PDB: d5g49a2 automated match to d4g92b_ complexed with act, ca |
PDB Entry: 5g49 (more details), 2.3 Å
SCOPe Domain Sequences for d5g49a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g49a1 a.22.1.3 (A:55-147) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} tvreqdrfmpianvirimrrilpahakisddsketiqecvseyisfitgeanercqreqr ktitaedvlwamsklgfddyiepltlylhryre
Timeline for d5g49a1: