Lineage for d5f05b2 (5f05 B:83-212)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714314Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries)
  8. 2714318Domain d5f05b2: 5f05 B:83-212 [326896]
    Other proteins in same PDB: d5f05a1, d5f05b1, d5f05c1, d5f05d1
    automated match to d1aw9a1
    complexed with 12p, gol, gsh, mg, pg4, pge

Details for d5f05b2

PDB Entry: 5f05 (more details), 1.7 Å

PDB Description: crystal structure of glutathione transferase f5 from populus trichocarpa
PDB Compounds: (B:) Phi class glutathione transferase GSTF5

SCOPe Domain Sequences for d5f05b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f05b2 a.45.1.0 (B:83-212) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gtqlgaagngyatilvwqeveshqfdpsasklvweqvfkpvfglptdaalvaetevtlgk
vldvyearlsqskylasdsftladlhhlpniqallgtpskklfdsrphvsawvasitgrp
awgkvlallp

SCOPe Domain Coordinates for d5f05b2:

Click to download the PDB-style file with coordinates for d5f05b2.
(The format of our PDB-style files is described here.)

Timeline for d5f05b2: