SCOP 1.71: Domain d1ytw__: 1ytw -

Lineage for d1ytw__ (1ytw -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (7 PDB entries)

8. Domain d1ytw__: 1ytw - [32689]
   complexed with so4, wo4

Details for d1ytw__

PDB Entry: 1ytw, 2.4 Å

PDB Description: yersinia ptpase complexed with tungstate

SCOP Domain Sequences for d1ytw__:

Sequence; same for both SEQRES and ATOM records:

>d1ytw__ c.45.1.2 (-) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d1ytw__:

• d1ytw__ first appeared (with stable ids) in SCOP 1.55
  
• d1ytw__ appears in SCOP 1.69
  
• d1ytw__ is called d1ytwa_ in SCOP 1.73
  
• d1ytw__ appears in the current release, SCOPe 2.08, called d1ytwa_