Lineage for d1ytw__ (1ytw -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (6 species) 
Species Yersinia enterocolitica [TaxId:630] [52812] (4 PDB entries) 
Domain d1ytw__: 1ytw - [32689]
Details for d1ytw__
PDB Entry: 1ytw (more details), 2.4 Å
PDB Description: yersinia ptpase complexed with tungstate
SCOP Domain Sequences for d1ytw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytw__ c.45.1.2 (-) Tyrosine phosphatase {Yersinia enterocolitica}
vspygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradln
anyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqs
gtygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevt
kalaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrns
qlsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
SCOP Domain Coordinates for d1ytw__:
Click to download the PDB-style file with coordinates for d1ytw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ytw__:
- d1ytw__ appears in SCOP 1.57
- d1ytw__ appears in the current release, SCOPe 2.08, called d1ytwa_
View in 3D