Lineage for d5ey3b3 (5ey3 B:336-440)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551902Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2552135Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2552153Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2552154Protein automated matches [254643] (5 species)
    not a true protein
  7. 2552172Species Salmonella typhimurium [TaxId:99287] [311467] (3 PDB entries)
  8. 2552174Domain d5ey3b3: 5ey3 B:336-440 [326885]
    Other proteins in same PDB: d5ey3a1, d5ey3a2, d5ey3a4, d5ey3b1, d5ey3b2
    automated match to d4x46b3
    complexed with ctn, edo, gol, so4

Details for d5ey3b3

PDB Entry: 5ey3 (more details), 1.91 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d5ey3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ey3b3 d.41.3.0 (B:336-440) automated matches {Salmonella typhimurium [TaxId: 99287]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

SCOPe Domain Coordinates for d5ey3b3:

Click to download the PDB-style file with coordinates for d5ey3b3.
(The format of our PDB-style files is described here.)

Timeline for d5ey3b3: