Lineage for d5ey3b2 (5ey3 B:71-335)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120359Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2120360Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2120361Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)
  6. 2120420Protein automated matches [254642] (3 species)
    not a true protein
  7. 2120433Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries)
  8. 2120435Domain d5ey3b2: 5ey3 B:71-335 [326884]
    Other proteins in same PDB: d5ey3a1, d5ey3a3, d5ey3a4, d5ey3b1, d5ey3b3
    automated match to d4x46b2
    complexed with ctn, edo, gol, so4

Details for d5ey3b2

PDB Entry: 5ey3 (more details), 1.91 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d5ey3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ey3b2 c.27.1.1 (B:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

SCOPe Domain Coordinates for d5ey3b2:

Click to download the PDB-style file with coordinates for d5ey3b2.
(The format of our PDB-style files is described here.)

Timeline for d5ey3b2: