| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) ![]() automatically mapped to Pfam PF00591 |
| Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins) |
| Protein automated matches [254642] (4 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries) |
| Domain d5ey3b2: 5ey3 B:71-335 [326884] Other proteins in same PDB: d5ey3a1, d5ey3a3, d5ey3a4, d5ey3b1, d5ey3b3 automated match to d4x46b2 complexed with ctn, edo, gol, so4 |
PDB Entry: 5ey3 (more details), 1.91 Å
SCOPe Domain Sequences for d5ey3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ey3b2 c.27.1.1 (B:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp
Timeline for d5ey3b2:
View in 3DDomains from other chains: (mouse over for more information) d5ey3a1, d5ey3a2, d5ey3a3, d5ey3a4 |