![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
![]() | Protein automated matches [254641] (6 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries) |
![]() | Domain d5ey3b1: 5ey3 B:1-70 [326883] Other proteins in same PDB: d5ey3a2, d5ey3a3, d5ey3a4, d5ey3b2, d5ey3b3 automated match to d4x46b1 complexed with ctn, edo, gol, so4 |
PDB Entry: 5ey3 (more details), 1.91 Å
SCOPe Domain Sequences for d5ey3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ey3b1 a.46.2.0 (B:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]} mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt mamrdsgtvl
Timeline for d5ey3b1:
![]() Domains from other chains: (mouse over for more information) d5ey3a1, d5ey3a2, d5ey3a3, d5ey3a4 |