SCOPe 2.08: Domain d5e22a1: 5e22 A:336-428

Lineage for d5e22a1 (5e22 A:336-428)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)

8. Domain d5e22a1: 5e22 A:336-428 [326881]
   Other proteins in same PDB: d5e22a2, d5e22b2
   automated match to d2vwra_
   complexed with gol

Details for d5e22a1

PDB Entry: 5e22, 1.8 Å

PDB Description: the second pdz domain of ligand of numb protein x 2 in the presence of an electric field of ~1 mv/cm along the crystallographic x axis, with eightfold extrapolation of structure factor differences.

PDB Compounds: (A:) ligand of numb protein x 2

SCOPe Domain Sequences for d5e22a1:

Sequence; same for both SEQRES and ATOM records:

>d5e22a1 b.36.1.0 (A:336-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlainghdl
kygtpelaaqiiqasgervnltiarpgkpeiel

Timeline for d5e22a1:

• d5e22a1 first appeared in SCOPe 2.06
  
• d5e22a1 appears in SCOPe 2.07