Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) |
Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
Protein automated matches [254643] (5 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [311467] (3 PDB entries) |
Domain d5ey3a3: 5ey3 A:336-440 [326879] Other proteins in same PDB: d5ey3a1, d5ey3a2, d5ey3a4, d5ey3b1, d5ey3b2 automated match to d4x46b3 complexed with ctn, edo, gol, so4 |
PDB Entry: 5ey3 (more details), 1.91 Å
SCOPe Domain Sequences for d5ey3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ey3a3 d.41.3.0 (A:336-440) automated matches {Salmonella typhimurium [TaxId: 99287]} tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite
Timeline for d5ey3a3: