Lineage for d5f6fb1 (5f6f B:2-139)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308455Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2308463Domain d5f6fb1: 5f6f B:2-139 [326875]
    Other proteins in same PDB: d5f6fa2, d5f6fb2
    automated match to d4llla_
    mutant

Details for d5f6fb1

PDB Entry: 5f6f (more details), 1.75 Å

PDB Description: s. aureus mepr g34r mutant
PDB Compounds: (B:) MarR family regulatory protein

SCOPe Domain Sequences for d5f6fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6fb1 a.4.5.0 (B:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

SCOPe Domain Coordinates for d5f6fb1:

Click to download the PDB-style file with coordinates for d5f6fb1.
(The format of our PDB-style files is described here.)

Timeline for d5f6fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f6fb2