Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226626] (6 PDB entries) |
Domain d5f69a_: 5f69 A: [326874] automated match to d2a24a_ complexed with gol |
PDB Entry: 5f69 (more details), 1.37 Å
SCOPe Domain Sequences for d5f69a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f69a_ d.110.3.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mfisrhsgegkflfidqratlvigflpqeilgtsfyeyfhnediaalmeshkmvmqvpek vttqvyrfrckdnsyiqlqsewrafknpatseidyiiaknsvf
Timeline for d5f69a_: