Lineage for d1yptb_ (1ypt B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24024Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 24035Protein Tyrosine phosphatase [52806] (6 species)
  7. 24072Species Yersinia enterocolitica [TaxId:630] [52812] (4 PDB entries)
  8. 24074Domain d1yptb_: 1ypt B: [32687]

Details for d1yptb_

PDB Entry: 1ypt (more details), 2.5 Å

PDB Description: crystal structure of yersinia protein tyrosine phosphatase at 2.5 angstroms and the complex with tungstate

SCOP Domain Sequences for d1yptb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yptb_ c.45.1.2 (B:) Tyrosine phosphatase {Yersinia enterocolitica}
ygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlnany
iqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsgty
gsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtkal
aslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsqls
vedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOP Domain Coordinates for d1yptb_:

Click to download the PDB-style file with coordinates for d1yptb_.
(The format of our PDB-style files is described here.)

Timeline for d1yptb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ypta_