SCOPe 2.06: Domain d5f06a2: 5f06 A:82-214

Lineage for d5f06a2 (5f06 A:82-214)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Populus trichocarpa [TaxId:3694] [326861] (6 PDB entries)

8. Domain d5f06a2: 5f06 A:82-214 [326862]
   Other proteins in same PDB: d5f06a1, d5f06b1
   automated match to d1aw9a1
   complexed with gsh, so4

Details for d5f06a2

PDB Entry: 5f06, 1.8 Å

PDB Description: crystal structure of glutathione transferase f7 from populus trichocarpa

PDB Compounds: (A:) Glutathione S-transferase family protein

SCOPe Domain Sequences for d5f06a2:

Sequence; same for both SEQRES and ATOM records:

>d5f06a2 a.45.1.0 (A:82-214) automated matches {Populus trichocarpa [TaxId: 3694]}
gydlirhenlkeaasvkvwteveshrynpaiapivfqfmvaplrgnspdqtiiddnvekl
gkvldiyeaklsstkylagdfysladlhhlpytyylmktpaasvvnerphvkawwediss
rpafkkvaegmnf

Timeline for d5f06a2:

• d5f06a2 is new in SCOPe 2.06-stable
  
• d5f06a2 appears in SCOPe 2.07
  
• d5f06a2 appears in the current release, SCOPe 2.08