| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [326861] (11 PDB entries) |
| Domain d5f06a2: 5f06 A:82-214 [326862] Other proteins in same PDB: d5f06a1, d5f06b1 automated match to d1aw9a1 complexed with gsh, so4 |
PDB Entry: 5f06 (more details), 1.8 Å
SCOPe Domain Sequences for d5f06a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f06a2 a.45.1.0 (A:82-214) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
gydlirhenlkeaasvkvwteveshrynpaiapivfqfmvaplrgnspdqtiiddnvekl
gkvldiyeaklsstkylagdfysladlhhlpytyylmktpaasvvnerphvkawwediss
rpafkkvaegmnf
Timeline for d5f06a2: