Lineage for d5bozl_ (5boz L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745477Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)
  8. 2745636Domain d5bozl_: 5boz L: [326858]
    Other proteins in same PDB: d5boza_, d5bozb_, d5bozc_, d5bozd_, d5boze_, d5bozf_
    automated match to d4u7sa_
    complexed with cl, so4

Details for d5bozl_

PDB Entry: 5boz (more details), 3.1 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh9)(e1)
PDB Compounds: (L:) VHH single chain antibody E1

SCOPe Domain Sequences for d5bozl_:

Sequence, based on SEQRES records: (download)

>d5bozl_ b.1.1.1 (L:) automated matches {Vicugna pacos [TaxId: 30538]}
mqvqlvesggglvqaggslrlscaasgrtfsrssmgwfrqapgkerefvasivwadgttl
ygdsvkgrftvsrdnvknmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqg
tqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d5bozl_ b.1.1.1 (L:) automated matches {Vicugna pacos [TaxId: 30538]}
mqvqlvesggglvqaggslrlscaasrtfsrssmgwfrqapgkerefvasivwadgttly
gdsvkgrftvsrdnnmvylqmnnlkpedtalyycadnkfvrglvavraidydywgqgtqv
tvs

SCOPe Domain Coordinates for d5bozl_:

Click to download the PDB-style file with coordinates for d5bozl_.
(The format of our PDB-style files is described here.)

Timeline for d5bozl_: