Lineage for d1gwz__ (1gwz -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395608Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 395609Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 395648Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 395674Protein Tyrosine phosphatase [52806] (7 species)
  7. 395745Species Human (Homo sapiens), shp-1 [TaxId:9606] [52811] (2 PDB entries)
  8. 395747Domain d1gwz__: 1gwz - [32685]

Details for d1gwz__

PDB Entry: 1gwz (more details), 2.5 Å

PDB Description: crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1

SCOP Domain Sequences for d1gwz__:

Sequence, based on SEQRES records: (download)

>d1gwz__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), shp-1}
feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
vgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgvpsepg
gvlsfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqkt
iqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk

Sequence, based on observed residues (ATOM records): (download)

>d1gwz__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), shp-1}
feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
vgmqraygpysvtncgehdtteyklrtlqvspgdlireiwhyqylswpdhgvpsepggvl
sfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqktiqm
vraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk

SCOP Domain Coordinates for d1gwz__:

Click to download the PDB-style file with coordinates for d1gwz__.
(The format of our PDB-style files is described here.)

Timeline for d1gwz__: