Lineage for d1gwz__ (1gwz -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70708Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 70719Protein Tyrosine phosphatase [52806] (7 species)
  7. 70751Species Human (Homo sapiens), shp-1 [TaxId:9606] [52811] (2 PDB entries)
  8. 70753Domain d1gwz__: 1gwz - [32685]

Details for d1gwz__

PDB Entry: 1gwz (more details), 2.5 Å

PDB Description: crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1

SCOP Domain Sequences for d1gwz__:

Sequence, based on SEQRES records: (download)

>d1gwz__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), shp-1}
feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
vgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgvpsepg
gvlsfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqkt
iqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk

Sequence, based on observed residues (ATOM records): (download)

>d1gwz__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), shp-1}
feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
vgmqraygpysvtncgehdtteyklrtlqvspgdlireiwhyqylswpdhgvpsepggvl
sfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqktiqm
vraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk

SCOP Domain Coordinates for d1gwz__:

Click to download the PDB-style file with coordinates for d1gwz__.
(The format of our PDB-style files is described here.)

Timeline for d1gwz__: