Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Human (Homo sapiens), shp-2 [TaxId:9606] [52810] (1 PDB entry) |
Domain d2shpb1: 2shp B:219-525 [32684] Other proteins in same PDB: d2shpa2, d2shpa3, d2shpb2, d2shpb3 contains tandem repeat of two SH2 domains in the N-terminal region complexed with cat; mutant |
PDB Entry: 2shp (more details), 2 Å
SCOP Domain Sequences for d2shpb1:
Sequence, based on SEQRES records: (download)
>d2shpb1 c.45.1.2 (B:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2} trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrsiymav qhyietl
>d2shpb1 c.45.1.2 (B:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2} trinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenknknryknilpfdht rvvlhdsdyinaniimpkksyiatqgclqntvndfwrmvfqensrvivmttkevergksk cvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwpdh gvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgvdc didvpktiqmvrsqrsgmvqteaqyrsiymavqhyietl
Timeline for d2shpb1: