Lineage for d5kand_ (5kan D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266951Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (2 PDB entries)
  8. 2266953Domain d5kand_: 5kan D: [326839]
    Other proteins in same PDB: d5kana_, d5kanc_, d5kane_, d5kani1, d5kani2, d5kank1, d5kank2, d5kanl1, d5kanl2
    automated match to d4d00d_
    complexed with nag

Details for d5kand_

PDB Entry: 5kan (more details), 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d5kand_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kand_ h.3.1.1 (D:) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik

SCOPe Domain Coordinates for d5kand_:

Click to download the PDB-style file with coordinates for d5kand_.
(The format of our PDB-style files is described here.)

Timeline for d5kand_: