SCOPe 2.08: Domain d5tp9a_: 5tp9 A:

Lineage for d5tp9a_ (5tp9 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193730] (34 PDB entries)

8. Domain d5tp9a_: 5tp9 A: [326817]
   Other proteins in same PDB: d5tp9b_
   automated match to d5i2ja_
   complexed with 7h0, act, ca, glu, gly

Details for d5tp9a_

PDB Entry: 5tp9, 2.4 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with compound 2 (gne9178)

PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 2A

SCOPe Domain Sequences for d5tp9a_:

Sequence, based on SEQRES records:

>d5tp9a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
qymtkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
ialqkgspwkrqidlallqfvgdgemeeletlwltgic

Sequence, based on observed residues (ATOM records):

>d5tp9a_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhlsivtleeapfvivedidetcvrntvpcrkfvkinnstnegmnvkkcckgfcidilkk
lsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvdfsv
pfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymhqym
tkfnqkgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgygial
qkgspwkrqidlallqfvgdgemeeletlwltgic

Timeline for d5tp9a_:

• d5tp9a_ first appeared in SCOPe 2.06
  
• d5tp9a_ appears in SCOPe 2.07