Lineage for d1yfoa_ (1yfo A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486243Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 486244Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 486283Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (5 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 486309Protein Tyrosine phosphatase [52806] (7 species)
  7. 486392Species Mouse (Mus musculus) [TaxId:10090] [52809] (1 PDB entry)
    receptor protein tyrosine phosphatase alpha, domain 1
  8. 486393Domain d1yfoa_: 1yfo A: [32681]

Details for d1yfoa_

PDB Entry: 1yfo (more details), 2.25 Å

PDB Description: receptor protein tyrosine phosphatase alpha, domain 1 from mouse

SCOP Domain Sequences for d1yfoa_:

Sequence, based on SEQRES records: (download)

>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus)}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgdvtnrkp
qrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvid
amldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly

Sequence, based on observed residues (ATOM records): (download)

>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus)}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly

SCOP Domain Coordinates for d1yfoa_:

Click to download the PDB-style file with coordinates for d1yfoa_.
(The format of our PDB-style files is described here.)

Timeline for d1yfoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfob_