![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5t5nj2: 5t5n J:108-212 [326808] Other proteins in same PDB: d5t5nf1, d5t5ng1, d5t5ng2, d5t5nh1, d5t5ni1, d5t5ni2, d5t5nj1, d5t5nk1, d5t5nk2, d5t5nl1, d5t5nm1, d5t5nm2, d5t5nn1, d5t5no1, d5t5no2 automated match to d1p7kl2 complexed with ca, cl, gol, k; mutant |
PDB Entry: 5t5n (more details), 3.1 Å
SCOPe Domain Sequences for d5t5nj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t5nj2 b.1.1.2 (J:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5t5nj2: