Lineage for d1rpmb_ (1rpm B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1851855Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1851899Protein Tyrosine phosphatase [52806] (7 species)
  7. 1852027Species Human (Homo sapiens), mu [TaxId:9606] [52808] (1 PDB entry)
    receptor protein tyrosine phosphatase mu, domain 1
  8. 1852029Domain d1rpmb_: 1rpm B: [32680]

Details for d1rpmb_

PDB Entry: 1rpm (more details), 2.3 Å

PDB Description: human receptor protein tyrosine phosphatase mu, domain 1
PDB Compounds: (B:) receptor protein tyrosine phosphatase mu

SCOPe Domain Sequences for d1rpmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rpmb_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]}
airvadllqhitqmkcaegygfkeeyesffegqsapwdsakkdenrmknrygniiaydhs
rvrlqtiegdtnsdyingnyidgyhrpnhyiatqgpmqetiydfwrmvwhentasiimvt
nlvevgrvkcckywpddteiykdikvtlietellaeyvirtfavekrgvheireirqfhf
tgwpdhgvpyhatgllgfvrqvksksppsagplvvhcsagagrtgcfividimldmaere
gvvdiyncvrelrsrrvnmvqteeqyvfihdaileacl

SCOPe Domain Coordinates for d1rpmb_:

Click to download the PDB-style file with coordinates for d1rpmb_.
(The format of our PDB-style files is described here.)

Timeline for d1rpmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rpma_