Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Human (Homo sapiens), mu [TaxId:9606] [52808] (1 PDB entry) receptor protein tyrosine phosphatase mu, domain 1 |
Domain d1rpmb_: 1rpm B: [32680] |
PDB Entry: 1rpm (more details), 2.3 Å
SCOPe Domain Sequences for d1rpmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rpmb_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} airvadllqhitqmkcaegygfkeeyesffegqsapwdsakkdenrmknrygniiaydhs rvrlqtiegdtnsdyingnyidgyhrpnhyiatqgpmqetiydfwrmvwhentasiimvt nlvevgrvkcckywpddteiykdikvtlietellaeyvirtfavekrgvheireirqfhf tgwpdhgvpyhatgllgfvrqvksksppsagplvvhcsagagrtgcfividimldmaere gvvdiyncvrelrsrrvnmvqteeqyvfihdaileacl
Timeline for d1rpmb_: