SCOPe 2.07: Domain d5tt7a1: 5tt7 A:358-635

Lineage for d5tt7a1 (5tt7 A:358-635)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase SYK [118131] (1 species)
   PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
   Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)

8. Domain d5tt7a1: 5tt7 A:358-635 [326791]
   Other proteins in same PDB: d5tt7a2
   automated match to d3tuca_
   complexed with 7kf

Details for d5tt7a1

PDB Entry: 5tt7, 1.77 Å

PDB Description: discovery of tak-659, an orally available investigational inhibitor of spleen tyrosine kinase (syk)

PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5tt7a1:

Sequence, based on SEQRES records:

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdel
laeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhq
vsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvk
wyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagc
premydlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records):

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmq
qldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyl
eesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecin
yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
nlcwtydvenrpgfaavelrlrnyyydvvn

Timeline for d5tt7a1:

• d5tt7a1 first appeared in SCOPe 2.06
  
• d5tt7a1 appears in the current release, SCOPe 2.08