Lineage for d5tt7a1 (5tt7 A:358-635)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983145Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983146Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2983176Domain d5tt7a1: 5tt7 A:358-635 [326791]
    Other proteins in same PDB: d5tt7a2
    automated match to d3tuca_
    complexed with 7kf

Details for d5tt7a1

PDB Entry: 5tt7 (more details), 1.77 Å

PDB Description: discovery of tak-659, an orally available investigational inhibitor of spleen tyrosine kinase (syk)
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d5tt7a1:

Sequence, based on SEQRES records: (download)

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdel
laeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhq
vsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvk
wyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagc
premydlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records): (download)

>d5tt7a1 d.144.1.7 (A:358-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
irpkevyldrklltledkelgsgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmq
qldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyl
eesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecin
yykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlm
nlcwtydvenrpgfaavelrlrnyyydvvn

SCOPe Domain Coordinates for d5tt7a1:

Click to download the PDB-style file with coordinates for d5tt7a1.
(The format of our PDB-style files is described here.)

Timeline for d5tt7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tt7a2