Lineage for d5kane_ (5kan E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775784Domain d5kane_: 5kan E: [326787]
    Other proteins in same PDB: d5kanb_, d5kand_, d5kanf_, d5kang_, d5kanh_, d5kani1, d5kani2, d5kanj_, d5kank1, d5kank2, d5kanl1, d5kanl2
    automated match to d2ypgc_
    complexed with nag

Details for d5kane_

PDB Entry: 5kan (more details), 2.79 Å

PDB Description: crystal structure of multidonor hv1-18-class broadly neutralizing influenza a antibody 16.g.07 in complex with a/hong kong/1-4-ma21- 1/1968 (h3n2) hemagglutinin
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d5kane_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kane_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
yvkqntlklatgmrnvpek

SCOPe Domain Coordinates for d5kane_:

Click to download the PDB-style file with coordinates for d5kane_.
(The format of our PDB-style files is described here.)

Timeline for d5kane_: