Lineage for d2hnp__ (2hnp -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (6 species) Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (24 PDB entries) 
Domain d2hnp__: 2hnp - [32678]
Details for d2hnp__
PDB Entry: 2hnp (more details), 2.8 Å
PDB Description: crystal structure of human protein tyrosine phosphatase 1b
SCOP Domain Sequences for d2hnp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnp__ c.45.1.2 (-) Tyrosine phosphatase {Human (Homo sapiens), 1B}
kefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedn
dyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqy
wpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgv
pespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssv
dikkvllemrkfrmgliqtadqlrfsylaviegakfim
SCOP Domain Coordinates for d2hnp__:
Click to download the PDB-style file with coordinates for d2hnp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hnp__:
- d2hnp__ appears in SCOP 1.57
- d2hnp__ appears in the current release, SCOPe 2.08, called d2hnpa_
View in 3D