![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5kank2: 5kan K:110-214 [326761] Other proteins in same PDB: d5kana_, d5kanb_, d5kanc_, d5kand_, d5kane_, d5kanf_, d5kang_, d5kanh_, d5kani1, d5kanj_, d5kank1, d5kanl1 automated match to d1gafl2 complexed with nag |
PDB Entry: 5kan (more details), 2.79 Å
SCOPe Domain Sequences for d5kank2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kank2 b.1.1.2 (K:110-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk dstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec
Timeline for d5kank2: